DLG1 Peptide - middle region
DLG1 Peptide - middle region
Product Specifications
Product Name Alternative
Hdlg, DLGH1, SAP97, SAP-97, dJ1061C18.1.1
UniProt
Q12959
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DLG1 Rabbit Polyclonal Antibody (orb588933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001091894.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
NBP2-73708UV 0.1 mL
Mouse Monoclonal PTK7/CCK4 Antibody (OTI2E7) [DyLight 350]
Sign In for Pricing
View Details 040093 200 µL
PKC nu (PRKD3, EPK2, PRKCN, Serine/threonine-protein kinase D3, Protein kinase C nu type, Protein kinase EPK2, nPKC-nu)
Sign In for Pricing
View Details 