Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLG1 Peptide - middle region

DLG1 Peptide - middle region

Product Specifications

Product Name Alternative

Hdlg, DLGH1, SAP97, SAP-97, dJ1061C18.1.1

UniProt

Q12959

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DLG1 Rabbit Polyclonal Antibody (orb588933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001091894.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYTRPVIILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Carbonic Anhydrase X/CA10 Antibody [Alexa Fluor 750]
NBP2-98120AF750 0.1 mL

Rabbit Polyclonal Carbonic Anhydrase X/CA10 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
JCAD shRNA (m) Lentiviral Particles
sc-146454-V 200 µL

JCAD shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
CDC42EP1 Protein Vector (Mouse) (pPB-C-His)
PV163818 500 ng

CDC42EP1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Ataxin-1 (Phospho-Ser776) Colorimetric Cell-Based ELISA Kit
MBS9518781-01 1 Kit

Ataxin-1 (Phospho-Ser776) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Ataxin-1 (Phospho-Ser776) Colorimetric Cell-Based ELISA Kit
MBS9518781-02 5x 1 Kit

Ataxin-1 (Phospho-Ser776) Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
TRADD, ID (TRADD, Tumor necrosis factor receptor type 1-associated DEATH domain protein, TNFRSF1A-associated via death domain) (MaxLight 750)
MBS6357833-01 0.1 mL

TRADD, ID (TRADD, Tumor necrosis factor receptor type 1-associated DEATH domain protein, TNFRSF1A-associated via death domain) (MaxLight 750)

Sign In for Pricing
View Details