Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD11 Peptide - middle region

CARD11 Peptide - middle region

Product Specifications

Product Name Alternative

PPBL, BENTA, BIMP3, IMD11, CARMA1

UniProt

Q8TES3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD11 Rabbit Polyclonal Antibody (orb588943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115791.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QA / Complement C1q A-Chain (C1QA/2956), Biotin conjugate, 0.1mg/mL
BNCB2956-500 1x 500 µL

C1QA / Complement C1q A-Chain (C1QA/2956), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KCNN2 Rabbit Polyclonal Antibody
ER1902-41 100 µL

KCNN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
9-Norketo FK-506
TRC-N692080-1MG 1 mg

9-Norketo FK-506

Sign In for Pricing
View Details
Human AIBZIP (CREB3L4) activation kit by CRISPRa
GA115669 1 Kit

Human AIBZIP (CREB3L4) activation kit by CRISPRa

Sign In for Pricing
View Details
C6orf146 (FAM217A) Human qPCR Primer Pair (NM_173563)
HP218377 200 Reactions

C6orf146 (FAM217A) Human qPCR Primer Pair (NM_173563)

Sign In for Pricing
View Details
ZNF124 (N-term) Rabbit Polyclonal Antibody
AP54669PU-N 400 µL

ZNF124 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details