Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CARD11 Peptide - middle region

CARD11 Peptide - middle region

Product Specifications

Product Name Alternative

PPBL, BENTA, BIMP3, IMD11, CARMA1

UniProt

Q8TES3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CARD11 Rabbit Polyclonal Antibody (orb588943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_115791.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SPRLSRASFLFGQLLQFVSRSENKYKRMNSNERVRIISGSPLGSLARSSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magnetic Stirrer, 7x7 inch, 115V
H3770-S 1 Each

Magnetic Stirrer, 7x7 inch, 115V

Sign In for Pricing
View Details
Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF647 conjugate, 0.1mg/mL
BNC472316-100 1x 100 µL

Cdk2 / p34cdc2 Serine-Threonine Kinase (AN4.3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit
RDR-P2RX7-Hu-01 96 Tests

Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details
Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit
RDR-P2RX7-Hu-02 48 Tests

Human Purinergic Receptor P2X, Ligand Gated Ion Channel 7 (P2RX7) ELISA Kit

Sign In for Pricing
View Details
b-D-Glucosamine Pentaacetate
TRC-G515000-25G 25 g

b-D-Glucosamine Pentaacetate

Sign In for Pricing
View Details
CD8A Mouse Monoclonal Antibody [Clone ID: C8/468 + C8/144B]
AM33320PU-S 100 µg

CD8A Mouse Monoclonal Antibody [Clone ID: C8/468 + C8/144B]

Sign In for Pricing
View Details