Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHL1 Peptide - N-terminal region

CHL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CALL, L1CAM2

UniProt

O00533

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHL1 Rabbit Polyclonal Antibody (orb588950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001240316.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF740 conjugate, 0.1mg/mL
BNC741867-100 1x 100 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MitoViewTM Green
#70054 20x 50 µg

MitoViewTM Green

Sign In for Pricing
View Details
(R)-BINAP
TRC-B386850-250MG 250 mg

(R)-BINAP

Sign In for Pricing
View Details
FBXO16 Human Gene Knockout Kit (CRISPR)
KN421371 1 Kit

FBXO16 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KLF14 (NM_138693) Human Recombinant Protein
TP313087L 1 mg

KLF14 (NM_138693) Human Recombinant Protein

Sign In for Pricing
View Details
IBRDC2 (RNF144B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11F4]
TA500699BM 100 µL

IBRDC2 (RNF144B) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI11F4]

Sign In for Pricing
View Details