Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHL1 Peptide - N-terminal region

CHL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CALL, L1CAM2

UniProt

O00533

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHL1 Rabbit Polyclonal Antibody (orb588950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001240316.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Activin A Receptor Type IB Antibody
RC-4172-01 50 μL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
Recombinant Activin A Receptor Type IB Antibody
RC-4172-02 100 µL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
Recombinant Activin A Receptor Type IB Antibody
RC-4172-03 1 mL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
Mouse Fech activation kit by CRISPRa
GA201382 1 Kit

Mouse Fech activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human ANGPTL8/β-trophin Protein (Fc Tag)
PKSH032067-01 10 µg

Recombinant Human ANGPTL8/β-trophin Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human ANGPTL8/β-trophin Protein (Fc Tag)
PKSH032067-02 50 µg

Recombinant Human ANGPTL8/β-trophin Protein (Fc Tag)

Sign In for Pricing
View Details