ADCY4 Peptide - middle region
ADCY4 Peptide - middle region
Product Specifications
Product Name Alternative
AC4
UniProt
B4DSJ6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ADCY4 Rabbit Polyclonal Antibody (orb589135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001185497.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15120972 1 Vial
Lentiviral mouse Tff1 shRNA (UAS) - Lentiviral mouse Tff1 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 033989-ML650 100 µL
CLEC9A, ID (CLEC9A, C-type lectin domain family 9 member A) (MaxLight 650) discontinued
Sign In for Pricing
View Details 
