Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCY4 Peptide - middle region

ADCY4 Peptide - middle region

Product Specifications

Product Name Alternative

AC4

UniProt

B4DSJ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCY4 Rabbit Polyclonal Antibody (orb589135) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001185497.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLRLLNE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VISTA/B7-H5/GI24 Rabbit pAb
MBS9148495-01 0.02 mL

VISTA/B7-H5/GI24 Rabbit pAb

Sign In for Pricing
View Details
VISTA/B7-H5/GI24 Rabbit pAb
MBS9148495-02 0.1 mL

VISTA/B7-H5/GI24 Rabbit pAb

Sign In for Pricing
View Details
VISTA/B7-H5/GI24 Rabbit pAb
MBS9148495-03 5x 0.1 mL

VISTA/B7-H5/GI24 Rabbit pAb

Sign In for Pricing
View Details
SLC7A11 Blocking Peptide
33R-4402 0.1 mg

SLC7A11 Blocking Peptide

Sign In for Pricing
View Details
RPE65 Polyclonal Antibody
MBS9129290-01 0.02 mL

RPE65 Polyclonal Antibody

Sign In for Pricing
View Details
RPE65 Polyclonal Antibody
MBS9129290-02 0.1 mL

RPE65 Polyclonal Antibody

Sign In for Pricing
View Details