Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KAT6A Peptide - N-terminal region

KAT6A Peptide - N-terminal region

Product Specifications

Product Name Alternative

MOZ, MRD32, MYST3, MYST-3, ZNF220, RUNXBP2, ZC2HC6A

UniProt

A5PLL3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KAT6A Rabbit Polyclonal Antibody (orb589344) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006757.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLDRKTVLEQLELSVKDGTILKVSNKGLNSYKDPDNPGRIALPKPRNHGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Nuclear Antigen (NM106), 1mg/mL
BNUM0106-50 1x 50 µL

Human Nuclear Antigen (NM106), 1mg/mL

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF640R conjugate, 0.1mg/mL
BNC402096-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (R1/69), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Langerin / CD207 (Marker of Langerhans Cells) (LGRN/1821), CF740 conjugate, 0.1mg/mL
BNC741821-500 1x 500 µL

Langerin / CD207 (Marker of Langerhans Cells) (LGRN/1821), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS1), CF405S conjugate, 0.1mg/mL
BNC041741-500 1x 500 µL

Epstein-Barr Virus (LMP-1) (CS1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF640R conjugate, 0.1mg/mL
BNC401633-500 1x 500 µL

Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16, CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF647 conjugate, 0.1mg/mL
BNC472225-100 1x 100 µL

FABP5 (Marker of Metastatic Potential in Colorectal Cancer) (CPTC-FABP5-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details