EFCAB13 Peptide - middle region
EFCAB13 Peptide - middle region
Product Specifications
Product Name Alternative
C17orf57
UniProt
Q8IY85
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EFCAB13 Rabbit Polyclonal Antibody (orb589348) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001182121.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ISKKLNKKSNQYYSKIMENDDLESKRPKNTWQIRKFLGGVGSSNVGVQEP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1198602-01 0.02 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR174C (YBR174C)
Sign In for Pricing
View Details MBS1198602-02 0.1 mg (E-Coli)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR174C (YBR174C)
Sign In for Pricing
View Details MBS1198602-03 0.02 mg (Yeast)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR174C (YBR174C)
Sign In for Pricing
View Details MBS1198602-04 0.1 mg (Yeast)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR174C (YBR174C)
Sign In for Pricing
View Details MBS1198602-05 0.02 mg (Baculovirus)
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein YBR174C (YBR174C)
Sign In for Pricing
View Details