Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGL Peptide - middle region

PYGL Peptide - middle region

Product Specifications

Product Name Alternative

GSD6

UniProt

P06737

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYGL Rabbit Polyclonal Antibody (orb589379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001157412.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANOG ELISA Kit (Human) : 96 Wells (OKEH02356)
OKEH02356 96 Well

NANOG ELISA Kit (Human) : 96 Wells (OKEH02356)

Sign In for Pricing
View Details
CHRNA5 Protein Vector (Mouse) (pPB-N-His)
PV165431 500 ng

CHRNA5 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Olfr319 Protein Vector (Mouse) (pPM-C-HA)
PV210140 500 ng

Olfr319 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rat Zwint ELISA Kit
ELI-51188r 96 Tests

Rat Zwint ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Rab29 shRNA (UAS) - Lentiviral mouseRab29 shRNA (UAS, GFP) (25)
GTR15267404 1 Vial

Lentiviral mouse Rab29 shRNA (UAS) - Lentiviral mouseRab29 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
PDE6B CRISPRa sgRNA lentivector (set of three targets)(Rat)
36290126 3x 1.0µg DNA

PDE6B CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details