Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGL Peptide - middle region

PYGL Peptide - middle region

Product Specifications

Product Name Alternative

GSD6

UniProt

P06737

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PYGL Rabbit Polyclonal Antibody (orb589379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001157412.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IVKTKVFKDFSELEPDKFQNKTNGITPRRWLLLCNPGLAELIAEKIGEDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2-1 Antibody
orb1317930-01 30 µL

NKX2-1 Antibody

Sign In for Pricing
View Details
NKX2-1 Antibody
orb1317930-02 50 μL

NKX2-1 Antibody

Sign In for Pricing
View Details
NKX2-1 Antibody
orb1317930-03 100 µL

NKX2-1 Antibody

Sign In for Pricing
View Details
Anti-PP1C alpha (1C11) Mouse Monoclonal Antibody
MA4683-.1 100 µL

Anti-PP1C alpha (1C11) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
GSR Rabbit Polyclonal Antibody (FITC)
orb2106846 100 µL

GSR Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
10-Bromo-2,2,6,6-tetramethyl-2H-1,5,7-trioxa-phenanthren-8-one
sc-287285A 500 mg

10-Bromo-2,2,6,6-tetramethyl-2H-1,5,7-trioxa-phenanthren-8-one

Sign In for Pricing
View Details