POTEE Peptide - middle region
POTEE Peptide - middle region
Product Specifications
Product Name Alternative
A26C1, POTE2, A26C1A, POTE-2, CT104.2, POTE2gamma
UniProt
A6NC16
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with POTEE Rabbit Polyclonal Antibody (orb589383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001077007.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQKQFCEEQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS435450-01 0.05 mL
Heat shock 70 kDa protein Mouse mAb for Straw mushroom
Sign In for Pricing
View Details MBS435450-02 0.1 mL
Heat shock 70 kDa protein Mouse mAb for Straw mushroom
Sign In for Pricing
View Details MBS435450-03 5x 0.1 mL
Heat shock 70 kDa protein Mouse mAb for Straw mushroom
Sign In for Pricing
View Details LKB84630-01 50 mg
Rac- (1R,2S,5S) -3-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-3-azabicyclo[3.1.0]hexane-2-carboxylic acid
Sign In for Pricing
View Details LKB84630-02 0.5 g
Rac- (1R,2S,5S) -3-{[ (9H-Fluoren-9-yl) methoxy]carbonyl}-3-azabicyclo[3.1.0]hexane-2-carboxylic acid
Sign In for Pricing
View Details