Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POTEE Peptide - middle region

POTEE Peptide - middle region

Product Specifications

Product Name Alternative

A26C1, POTE2, A26C1A, POTE-2, CT104.2, POTE2gamma

UniProt

A6NC16

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POTEE Rabbit Polyclonal Antibody (orb589383) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001077007.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQKQFCEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HMGXB3 Rabbit Polyclonal Antibody (Biotin)
orb454973 100 µL

HMGXB3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Goat Interleukin 32 ELISA Kit
MBS742101-01 48 Well

Goat Interleukin 32 ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 32 ELISA Kit
MBS742101-02 96 Well

Goat Interleukin 32 ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 32 ELISA Kit
MBS742101-03 5x 96 Well

Goat Interleukin 32 ELISA Kit

Sign In for Pricing
View Details
Goat Interleukin 32 ELISA Kit
MBS742101-04 10x 96 Well

Goat Interleukin 32 ELISA Kit

Sign In for Pricing
View Details
Neurog1 Rabbit Polyclonal Antibody (HRP)
orb2130891 100 µL

Neurog1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details