PIK3CA Peptide - middle region
PIK3CA Peptide - middle region
Product Specifications
Product Name Alternative
MCM, CWS5, MCAP, PI3K, CLOVE, MCMTC, p110-alpha
UniProt
P42337
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIK3CA Rabbit Polyclonal Antibody (orb589408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006209.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
bs-41214R-BF488 100 µL
NCR1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
Sign In for Pricing
View Details K0883505 3x 1.0 µg
GOPC sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
