PIK3CA Peptide - middle region
PIK3CA Peptide - middle region
Product Specifications
Product Name Alternative
MCM, CWS5, MCAP, PI3K, CLOVE, MCMTC, p110-alpha
UniProt
P42337
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PIK3CA Rabbit Polyclonal Antibody (orb589408) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006209.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
N0019-04C-HRP 200 µL
NAT2, CT (N-acetyltransferase Type 2, NAT-2, Arylamine N-acetyltransferase 2, Arylamide Acetylase 2, AAC2, Polymorphic Arylamine N-acetyltransferase, PNAT) (Azide free) (HRP) discontinued
Sign In for Pricing
View Details 
