Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIS3L Peptide - middle region

DIS3L Peptide - middle region

Product Specifications

Product Name Alternative

DIS3L1

UniProt

Q8TF46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIS3L Rabbit Polyclonal Antibody (orb589516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001137160.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-STMN1-S16 Rabbit pAb (AMR00874N)
AMR00874N-01 50 µL

Phospho-STMN1-S16 Rabbit pAb (AMR00874N)

Sign In for Pricing
View Details
Phospho-STMN1-S16 Rabbit pAb (AMR00874N)
AMR00874N-02 100 µL

Phospho-STMN1-S16 Rabbit pAb (AMR00874N)

Sign In for Pricing
View Details
Phospho-STMN1-S16 Rabbit pAb (AMR00874N)
AMR00874N-03 200 µL

Phospho-STMN1-S16 Rabbit pAb (AMR00874N)

Sign In for Pricing
View Details
G15
S6651-5mg 5 mg

G15

Sign In for Pricing
View Details
LFNG Protein Lysate (Mouse) with C-HA Tag
26459034 100 µg

LFNG Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
TOE1 Rabbit mAb
orb2707104-01 20 ul

TOE1 Rabbit mAb

Sign In for Pricing
View Details