Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIS3L Peptide - middle region

DIS3L Peptide - middle region

Product Specifications

Product Name Alternative

DIS3L1

UniProt

Q8TF46

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIS3L Rabbit Polyclonal Antibody (orb589516) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001137160.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKSGRYIQGI

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-96-3p miRNA Inhibitor
MBS8293293-01 10 nmol

hsa-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-96-3p miRNA Inhibitor
MBS8293293-02 20 nmol

hsa-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
hsa-miR-96-3p miRNA Inhibitor
MBS8293293-03 5x 20 nmol

hsa-miR-96-3p miRNA Inhibitor

Sign In for Pricing
View Details
LGALS4, NT (LGALS4, Galectin-4, Antigen NY-CO-27, L-36 lactose-binding protein, Lactose-binding lectin 4) (MaxLight 750) discontinued
037747-ML750 100 µL

LGALS4, NT (LGALS4, Galectin-4, Antigen NY-CO-27, L-36 lactose-binding protein, Lactose-binding lectin 4) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ACTN3 (FITC)
554371-01 50 µg

ACTN3 (FITC)

Sign In for Pricing
View Details
ACTN3 (FITC)
554371-02 100 µg

ACTN3 (FITC)

Sign In for Pricing
View Details