Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASK Peptide - middle region

CASK Peptide - middle region

Product Specifications

Product Name Alternative

CMG, FGS4, LIN2, TNRC8, CAGH39, CAMGUK, MICPCH, MRXSNA

UniProt

O14936

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASK Rabbit Polyclonal Antibody (orb589684) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001119526.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HPDRFAYPIPHTTRPPKKDEENGKNYYFVSHDQMMQDISNNEYLEYGSHE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit ATP binding cassette sub family D member 4 (ABCD4) ELISA kit
GTR10403881 96 Well

Rabbit ATP binding cassette sub family D member 4 (ABCD4) ELISA kit

Sign In for Pricing
View Details
Anti-SLC25A34 Antibody Picoband® FITC Conjugated
A16597-1-FITC 100 µg/Vial

Anti-SLC25A34 Antibody Picoband® FITC Conjugated

Sign In for Pricing
View Details
N-Nitroso Demethyl prochlorperazine
CS-O-50282 1 Each

N-Nitroso Demethyl prochlorperazine

Sign In for Pricing
View Details
Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT
E0340Ca-01 48 Well

Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT

Sign In for Pricing
View Details
Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT
E0340Ca-02 96 Well

Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT

Sign In for Pricing
View Details
Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT
E0340Ca-03 5x 96 Tests

Canine Cystic fibrosis transmembrane conductance regulator, CFTR ELISA KIT

Sign In for Pricing
View Details