BTD Peptide - middle region
BTD Peptide - middle region
Product Specifications
UniProt
P43251
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BTD Rabbit Polyclonal Antibody (orb589690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000051.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15140063 1 Vial
Lentiviral human C10orf67 shRNA (UAS) - Lentiviral human C10orf67 shRNA (UAS, RFP) (25)
Sign In for Pricing
View Details 