Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BTD Peptide - middle region

BTD Peptide - middle region

Product Specifications

UniProt

P43251

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BTD Rabbit Polyclonal Antibody (orb589690) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_000051.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CK2 alpha Blocking Peptide
CBP4617-01 1 mg

CK2 alpha Blocking Peptide

Sign In for Pricing
View Details
CK2 alpha Blocking Peptide
CBP4617-02 5 mg

CK2 alpha Blocking Peptide

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Sumo Tag)
PDEH100542-01 20 µg

Recombinant Human CASP8 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Sumo Tag)
PDEH100542-02 100 µg

Recombinant Human CASP8 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Sumo Tag)
PDEH100542-03 500 µg

Recombinant Human CASP8 Protein (Sumo Tag)

Sign In for Pricing
View Details
Recombinant Human CASP8 Protein (Sumo Tag)
PDEH100542-04 1 mg

Recombinant Human CASP8 Protein (Sumo Tag)

Sign In for Pricing
View Details