PNPLA2 Peptide - middle region
PNPLA2 Peptide - middle region
Product Specifications
Product Name Alternative
ATGL, TTS2, PEDF-R, FP17548, TTS-2.2, iPLA2zeta, 1110001C14Rik
UniProt
Q96AD5
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PNPLA2 Rabbit Polyclonal Antibody (orb589695) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_065109.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1570160-01 0.1 mg
InVivoMAb Anti-Human CD307e/FCRL5 Antibody (Iv0127)
Sign In for Pricing
View Details