Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPN1 Peptide - middle region

CAPN1 Peptide - middle region

Product Specifications

Product Name Alternative

CANP, muCL, CANP1, CANPL1, muCANP

UniProt

P07384

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CAPN1 Rabbit Polyclonal Antibody (orb589696) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001185797.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PATFWVNPQFKIRLDETDDPDDYGDRESGCSFVLALMQKHRRRERRFGRD

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACOT7 Antibody
orb352703-01 50 μL

ACOT7 Antibody

Sign In for Pricing
View Details
ACOT7 Antibody
orb352703-02 100 µL

ACOT7 Antibody

Sign In for Pricing
View Details
Anti-RIMKLA Antibody Picoband® (Dylight488 Conjugate)
A11921-2-Dylight488 100 µg

Anti-RIMKLA Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
WDR46 Protein Vector (Rat) (pPM-C-HA)
PV316360 500 ng

WDR46 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TRPV6 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-15506R-BF405 100 µL

TRPV6 Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Human HRG Knockout HEK293T cell line
GTR15411145 1 Vial

Human HRG Knockout HEK293T cell line

Sign In for Pricing
View Details