CYP26B1 Peptide - middle region
CYP26B1 Peptide - middle region
Product Specifications
Product Name Alternative
RHFCA, CYP26A2, P450RAI2, P450RAI-2
UniProt
Q9NR63
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYP26B1 Rabbit Polyclonal Antibody (orb589697) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001264671.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: APVFKDVNVFDPDRFSQARSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Rat Monoclonal BTLA/CD272 Antibody (753131) [DyLight 350]](https://cdn.genprice.uk/genprice/uk/genprice2.webp)
FAB7600D 0.1 mL
Rat Monoclonal BTLA/CD272 Antibody (753131) [DyLight 350]
Sign In for Pricing
View Details MBS1156105-01 0.02 mg (E-Coli)
Recombinant Rhesus papillomavirus type 1 Regulatory protein E2 (E2)
Sign In for Pricing
View Details MBS1156105-02 0.02 mg (Yeast)
Recombinant Rhesus papillomavirus type 1 Regulatory protein E2 (E2)
Sign In for Pricing
View Details MBS1156105-03 0.1 mg (E-Coli)
Recombinant Rhesus papillomavirus type 1 Regulatory protein E2 (E2)
Sign In for Pricing
View Details MBS1156105-04 0.1 mg (Yeast)
Recombinant Rhesus papillomavirus type 1 Regulatory protein E2 (E2)
Sign In for Pricing
View Details