CSF2RB Peptide - middle region
CSF2RB Peptide - middle region
Product Specifications
Product Name Alternative
CD131, IL3RB, IL5RB, SMDP5, CDw131
UniProt
B4DZL8
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CSF2RB Rabbit Polyclonal Antibody (orb589698) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000386.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HTPEKQASSFDFNGPYLGPPHSRSLPDILGQPEPPQEGGSQKSPPPGSLE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2054640-01 0.1 mL
FITC-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3)
Sign In for Pricing
View Details MBS2054640-02 0.2 mL
FITC-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3)
Sign In for Pricing
View Details MBS2054640-03 0.5 mL
FITC-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3)
Sign In for Pricing
View Details MBS2054640-04 1 mL
FITC-Linked Polyclonal Antibody to Leukocyte Immunoglobulin Like Receptor Subfamily A, Member 3 (LILRA3)
Sign In for Pricing
View Details