Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATG3 Peptide - middle region

ATG3 Peptide - middle region

Product Specifications

Product Name Alternative

APG3, APG3L, PC3-96, APG3-LIKE

UniProt

Q9NT62

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATG3 Rabbit Polyclonal Antibody (orb589700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265641.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDDGDGGWVDTYHNTGITGITEAVKEITLENKDNIRLQDCSALCEEEEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (4-Chloro-2-methyl-3-oxobutan-2-yl) -2,3-dihydro-1H-isoindole-1,3-dione
DXC60432-01 50 mg

2- (4-Chloro-2-methyl-3-oxobutan-2-yl) -2,3-dihydro-1H-isoindole-1,3-dione

Sign In for Pricing
View Details
2- (4-Chloro-2-methyl-3-oxobutan-2-yl) -2,3-dihydro-1H-isoindole-1,3-dione
DXC60432-02 0.5 g

2- (4-Chloro-2-methyl-3-oxobutan-2-yl) -2,3-dihydro-1H-isoindole-1,3-dione

Sign In for Pricing
View Details
RNF114 (RING Finger Protein 114)
490640 100 µL

RNF114 (RING Finger Protein 114)

Sign In for Pricing
View Details
Rocker Scales - 0.5 Litre Capacity
1150650 1 Each

Rocker Scales - 0.5 Litre Capacity

Sign In for Pricing
View Details
Lentiviral human OR14K1 sgRNA gene knockout kit - Lentiviral human OR14K1 sgRNA gene knockout kit (plasmid)
GTR15389291 1 Vial

Lentiviral human OR14K1 sgRNA gene knockout kit - Lentiviral human OR14K1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
SW480 Luciferase Reporter Cell Line
ABC-RC215H 1 Vial

SW480 Luciferase Reporter Cell Line

Sign In for Pricing
View Details