Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD17 Peptide - middle region

RAD17 Peptide - middle region

Product Specifications

Product Name Alternative

CCYC, R24L, RAD24, HRAD17, RAD17SP

UniProt

O75943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD17 Rabbit Polyclonal Antibody (orb589702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265551.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMSLKSDAVLSKSKRR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eci1 (NM_017306) Rat Tagged Lenti ORF Clone
RR203501L4 10 µg

Eci1 (NM_017306) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
HMGB1P40 Protein Lysate (Human) with C-Ha Tag
23530031 100 µg

HMGB1P40 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
GABRP Antibody
31-108 100 µL

GABRP Antibody

Sign In for Pricing
View Details
RPE65 Polyclonal Antibody, APC Conjugated
bs-9575R-APC 100 µL

RPE65 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
M-PEG-thiol (MW 750)
orb3027049-01 1 g

M-PEG-thiol (MW 750)

Sign In for Pricing
View Details
M-PEG-thiol (MW 750)
orb3027049-02 500 mg

M-PEG-thiol (MW 750)

Sign In for Pricing
View Details