Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAD17 Peptide - middle region

RAD17 Peptide - middle region

Product Specifications

Product Name Alternative

CCYC, R24L, RAD24, HRAD17, RAD17SP

UniProt

O75943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAD17 Rabbit Polyclonal Antibody (orb589702) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265551.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMSLKSDAVLSKSKRR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep B-type Natriuretic Peptide,BNP ELISA KIT
JOT-EK0117Sh 96 wells

Sheep B-type Natriuretic Peptide,BNP ELISA KIT

Sign In for Pricing
View Details
CBWD2 Rabbit Polyclonal Antibody
orb3013697 100 µL

CBWD2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)
MBS1328595-01 0.05 mg (E-Coli)

Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)

Sign In for Pricing
View Details
Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)
MBS1328595-02 0.05 mg (Yeast)

Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)

Sign In for Pricing
View Details
Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)
MBS1328595-03 0.2 mg (E-Coli)

Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)

Sign In for Pricing
View Details
Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)
MBS1328595-04 0.05 mg (Baculovirus)

Recombinant Emericella nidulans Pre-rRNA-processing protein esf2 (esf2)

Sign In for Pricing
View Details