Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ4 Peptide - C-terminal region

KCNQ4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFNA2, KV7.4, DFNA2A

UniProt

P56696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ4 Rabbit Polyclonal Antibody (orb589707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004691.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEISMMGRVVKVEKQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Dichlorocyclohexane (>85%)
TRC-D905170-5MG 5 mg

1,3-Dichlorocyclohexane (>85%)

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Dihydro-3,4-diphenyl-2,5-furandione;
TRC-D494055-250MG 250 mg

Dihydro-3,4-diphenyl-2,5-furandione;

Sign In for Pricing
View Details
U1A (SNRPA) Rabbit Polyclonal Antibody
TA369764 100 µL

U1A (SNRPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
KC-17722-01 50 μL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details
Alpha A Crystallin Antibody
KC-17722-02 100 µL

Alpha A Crystallin Antibody

Sign In for Pricing
View Details