Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ4 Peptide - C-terminal region

KCNQ4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFNA2, KV7.4, DFNA2A

UniProt

P56696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ4 Rabbit Polyclonal Antibody (orb589707) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004691.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEISMMGRVVKVEKQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium Fluoroacetate
TRC-S960143-25MG 25 mg

Sodium Fluoroacetate

Sign In for Pricing
View Details
(-)-Inosine
TRC-I661000-1KG 1 Kg

(-)-Inosine

Sign In for Pricing
View Details
MAP126 (SPAG5) Human Gene Knockout Kit (CRISPR)
KN401783 1 Kit

MAP126 (SPAG5) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS629116 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CD34 Polyclonal Antibody
E-AB-60105-01 60 µL

CD34 Polyclonal Antibody

Sign In for Pricing
View Details
CD34 Polyclonal Antibody
E-AB-60105-02 120 µL

CD34 Polyclonal Antibody

Sign In for Pricing
View Details