Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBK Peptide - middle region

PBK Peptide - middle region

Product Specifications

Product Name Alternative

SPK, CT84, TOPK, HEL164, Nori-3

UniProt

Q96KB5

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PBK Rabbit Polyclonal Antibody (orb589714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPI

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRMT8 Chemiluminescent Assay Kit
52062 96 rxns.

PRMT8 Chemiluminescent Assay Kit

Sign In for Pricing
View Details
Mmu-miR-466e-3p miRNA Inhibitor
CIM0517-01 10 nmol

Mmu-miR-466e-3p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-466e-3p miRNA Inhibitor
CIM0517-02 20 nmol

Mmu-miR-466e-3p miRNA Inhibitor

Sign In for Pricing
View Details
ACSS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
11226066 1.0 µg DNA

ACSS1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
EphA2/5 Polyclonal Antibody
JOT-AP02997-01 50ul

EphA2/5 Polyclonal Antibody

Sign In for Pricing
View Details
EphA2/5 Polyclonal Antibody
JOT-AP02997-02 100ul

EphA2/5 Polyclonal Antibody

Sign In for Pricing
View Details