Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PBK Peptide - middle region

PBK Peptide - middle region

Product Specifications

Product Name Alternative

SPK, CT84, TOPK, HEL164, Nori-3

UniProt

Q96KB5

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PBK Rabbit Polyclonal Antibody (orb589714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001265874.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPI

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iridin
MBS3608641-01 5 mg

Iridin

Sign In for Pricing
View Details
Iridin
MBS3608641-02 5x 5 mg

Iridin

Sign In for Pricing
View Details
Magnetic Beads-conjugated Mouse anti DDDDK-Tag mAb
AE037-01 500 μL

Magnetic Beads-conjugated Mouse anti DDDDK-Tag mAb

Sign In for Pricing
View Details
Magnetic Beads-conjugated Mouse anti DDDDK-Tag mAb
AE037-02 1000 μL

Magnetic Beads-conjugated Mouse anti DDDDK-Tag mAb

Sign In for Pricing
View Details
Oncofetal Antigen 5T4, ID (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (FITC) discontinued
043153-FITC 200 µL

Oncofetal Antigen 5T4, ID (TPBG, Trophoblast Glycoprotein, 5T4 Oncofetal antigen, 5T4 Oncofetal Trophoblast Glycoprotein, M6P1) (FITC) discontinued

Sign In for Pricing
View Details
CD200 Recombinant Protein
orb1227932 0.1 mg

CD200 Recombinant Protein

Sign In for Pricing
View Details