Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHX2 Peptide - middle region

EPHX2 Peptide - middle region

Product Specifications

Product Name Alternative

CEH, SEH

UniProt

P34913

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHX2 Rabbit Polyclonal Antibody (orb589721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRT

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCRA ELISA Kit (Human)
OKEH08635-96W 96 Tests

TCRA ELISA Kit (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal ARFGEF1 Antibody [CoraFluor 1]
NB100-55257CL1 0.1 mL

Rabbit Polyclonal ARFGEF1 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
HHLA2 (NM_001282558) Human Tagged ORF Clone
RC237962 10 µg

HHLA2 (NM_001282558) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Human BRDT Protein, N-His
HA831012-01 50 µg

Recombinant Human BRDT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BRDT Protein, N-His
HA831012-02 100 µg

Recombinant Human BRDT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human BRDT Protein, N-His
HA831012-03 1 mg

Recombinant Human BRDT Protein, N-His

Sign In for Pricing
View Details