Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPHX2 Peptide - middle region

EPHX2 Peptide - middle region

Product Specifications

Product Name Alternative

CEH, SEH

UniProt

P34913

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPHX2 Rabbit Polyclonal Antibody (orb589721) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001243411.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VASLNTPFIPANPNMSPLESIKANPVFDYQLYFQEPGVAEAELEQNLSRT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CHRNA7 (Rabbit, Polyclonal)
A001679 100 µL

Anti-CHRNA7 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
CDKAL1 Antibody, Biotin conjugated
A57392-100UG 100 µg

CDKAL1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (AP) discontinued
253121-AP 100 µL

TUBA1 (Tubulin, alpha 4a, FLJ30169, H2-ALPHA, TUBA1) (AP) discontinued

Sign In for Pricing
View Details
Casein Kinase 2 beta (CSNK2B) Human Over-expression Lysate
orb1378956 20 µg

Casein Kinase 2 beta (CSNK2B) Human Over-expression Lysate

Sign In for Pricing
View Details
THAP1 Protein Vector (Human) (pPB-C-His)
PV041913 500 ng

THAP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
FCER1A Recombinant Protein (Human)
OPCA04406-20UG 20 µg

FCER1A Recombinant Protein (Human)

Sign In for Pricing
View Details