Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GIT1 Peptide - middle region

GIT1 Peptide - middle region

Product Specifications

UniProt

Q9Y2X7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GIT1 Rabbit Polyclonal Antibody (orb589724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001078923.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RKGVSASAVPFTPSSPLLSCSQEGSRHTSKLSRHGSGADSDYENTQSGDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bach2 sgRNA CRISPR Lentivector set (Mouse)
K3923401 3x 1.0 µg

Bach2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Human TIMM29 Protein, N-His
HP403012-01 50 µg

Recombinant Human TIMM29 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TIMM29 Protein, N-His
HP403012-02 100 µg

Recombinant Human TIMM29 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human TIMM29 Protein, N-His
HP403012-03 1 mg

Recombinant Human TIMM29 Protein, N-His

Sign In for Pricing
View Details
Simian NTXI (CrossLinked N-telopeptide of Type I Collagen) ELISA Kit
ELK9626-01 48 Tests

Simian NTXI (CrossLinked N-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Simian NTXI (CrossLinked N-telopeptide of Type I Collagen) ELISA Kit
ELK9626-02 96 Tests

Simian NTXI (CrossLinked N-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details