Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK2 Peptide - N-terminal region

PLK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SNK, hSNK, hPlk2

UniProt

Q9NYY3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLK2 Rabbit Polyclonal Antibody (orb589727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001239155.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL)
orb2932415-01 20 µg

Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL)
orb2932415-02 100 µg

Recombinant Yersinia pseudotuberculosis serotype O:1b Large-conductance mechanosensitive channel (mscL)

Sign In for Pricing
View Details
RASSF6 sgRNA CRISPR Lentivector (Human) (Target 1)
K1790202 1.0 µg DNA

RASSF6 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Scandium (III) oxide
sc-250968C 100 g

Scandium (III) oxide

Sign In for Pricing
View Details
PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of Multicatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (FITC)
029282 100 µg

PSME2 (Proteasome Activator Complex Subunit 2, Proteasome Activator 28 Subunit beta, PA28beta, PA28b, Activator Of Multicatalytic Protease Subunit 2, 11S Regulator Complex Subunit beta, REG-beta) (FITC)

Sign In for Pricing
View Details
Wdsub1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50391114 3x 1.0 µg

Wdsub1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details