Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLK2 Peptide - N-terminal region

PLK2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SNK, hSNK, hPlk2

UniProt

Q9NYY3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLK2 Rabbit Polyclonal Antibody (orb589727) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001239155.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AASTKMCEQALGKGCGADSKKKRPPQPPEESQPPQSQAQVPPAAPHHHHH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPLK/GFP+Puro-SUMO2 shRNA-2
PPL00794-3b 1 Each

PPLK/GFP+Puro-SUMO2 shRNA-2

Sign In for Pricing
View Details
Anti-DR5/TNFRSF10B Antibody Picoband®
PA1842 100 µg/Vial

Anti-DR5/TNFRSF10B Antibody Picoband®

Sign In for Pricing
View Details
Nephronophthisis (NPHP1) (NM_000272) Human Tagged Lenti ORF Clone
RC222151L4 10 µg

Nephronophthisis (NPHP1) (NM_000272) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Abelacimab Biosimilar - Research Grade
ICH5322-20mg 20 mg

Abelacimab Biosimilar - Research Grade

Sign In for Pricing
View Details
GRID1
CSB-CL891738HU2 10 μg Plasmid + 200 μL Glycerol

GRID1

Sign In for Pricing
View Details
Mouse Diacylglycerol kinase theta (DGKQ) ELISA Kit
AE47357MO-01 48 Tests

Mouse Diacylglycerol kinase theta (DGKQ) ELISA Kit

Sign In for Pricing
View Details