PMS1 Peptide - middle region
PMS1 Peptide - middle region
Product Specifications
Product Name Alternative
MLH2, PMSL1, hPMS1, HNPCC3
UniProt
P54277
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PMS1 Rabbit Polyclonal Antibody (orb331457) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_000525.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQD
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1350565-01 0.02 mg (E-Coli)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details MBS1350565-02 0.02 mg (Yeast)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details MBS1350565-03 0.1 mg (E-Coli)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details 
MBS1350565-04 0.1 mg (Yeast)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details MBS1350565-05 0.02 mg (Baculovirus)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details 
MBS1350565-06 0.02 mg (Mammalian-Cell)
Recombinant Salmonella typhimurium Protein fixC (fixC)
Sign In for Pricing
View Details