Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR12 Peptide - middle region

WDR12 Peptide - middle region

Product Specifications

Product Name Alternative

YTM1

UniProt

Q9GZL7

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR12 Rabbit Polyclonal Antibody (orb588388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060726.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQL

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD209 Antibody - N-terminal region : HRP (ARP42586_P050-HRP)
ARP42586_P050-HRP 100 µL

CD209 Antibody - N-terminal region : HRP (ARP42586_P050-HRP)

Sign In for Pricing
View Details
Mouse Spaca1 activation kit by CRISPRa
GA207439 1 Kit

Mouse Spaca1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human PIM2 ELISA Kit
orb441578-01 48 Tests

Human PIM2 ELISA Kit

Sign In for Pricing
View Details
Human PIM2 ELISA Kit
orb441578-02 96 Tests

Human PIM2 ELISA Kit

Sign In for Pricing
View Details
UFD1L Antibody Antigenic Blocking Peptide
MBS544634-01 0.25 mg

UFD1L Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details
UFD1L Antibody Antigenic Blocking Peptide
MBS544634-02 5x 0.25 mg

UFD1L Antibody Antigenic Blocking Peptide

Sign In for Pricing
View Details