WDR12 Peptide - middle region
WDR12 Peptide - middle region
Product Specifications
Product Name Alternative
YTM1
UniProt
Q9GZL7
Field of Research
Cancer Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR12 Rabbit Polyclonal Antibody (orb588388) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_060726.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SIAVDGSGTKFCSGSWDKMLKIWSTVPTDEEDEMEESTNRPRKKQKTEQL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1322146-01 0.02 mg (E-Coli)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details 
MBS1322146-02 0.1 mg (E-Coli)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details MBS1322146-03 0.02 mg (Yeast)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details MBS1322146-04 0.1 mg (Yeast)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details MBS1322146-05 0.02 mg (Baculovirus)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details MBS1322146-06 1 mg (E-Coli)
Recombinant Mouse Cytochrome b-c1 complex subunit 7 (Uqcrb)
Sign In for Pricing
View Details