PRPSAP1 Peptide - middle region
PRPSAP1 Peptide - middle region
Product Specifications
Product Name Alternative
PAP39
UniProt
Q14558
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRPSAP1 Rabbit Polyclonal Antibody (orb588665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_002757.2
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASML
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6319372-01 0.1 mL
MBL2, CT (MBL2, COLEC1, MBL, Mannose-binding protein C, Collectin-1, MBP1, Mannan-binding protein, Mannose-binding lectin) (MaxLight 650)
Sign In for Pricing
View Details MBS6319372-02 5x 0.1 mL
MBL2, CT (MBL2, COLEC1, MBL, Mannose-binding protein C, Collectin-1, MBP1, Mannan-binding protein, Mannose-binding lectin) (MaxLight 650)
Sign In for Pricing
View Details