Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRPSAP1 Peptide - middle region

PRPSAP1 Peptide - middle region

Product Specifications

Product Name Alternative

PAP39

UniProt

Q14558

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRPSAP1 Rabbit Polyclonal Antibody (orb588665) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_002757.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASML

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-TAK1 (Ser439) Rabbit mAb
orb1563034-01 20 ul

Phospho-TAK1 (Ser439) Rabbit mAb

Sign In for Pricing
View Details
Phospho-TAK1 (Ser439) Rabbit mAb
orb1563034-02 50 µL

Phospho-TAK1 (Ser439) Rabbit mAb

Sign In for Pricing
View Details
Phospho-TAK1 (Ser439) Rabbit mAb
orb1563034-03 100 µL

Phospho-TAK1 (Ser439) Rabbit mAb

Sign In for Pricing
View Details
Ebf1 ORF Vector (Mouse) (pORF)
ORF043561 1.0 µg DNA

Ebf1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
1,3-Diacetyl-2-imidazolidinone
411006-01 500 mg

1,3-Diacetyl-2-imidazolidinone

Sign In for Pricing
View Details
1,3-Diacetyl-2-imidazolidinone
411006-02 2.5 g

1,3-Diacetyl-2-imidazolidinone

Sign In for Pricing
View Details