Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHACTR2 Peptide - C-terminal region

PHACTR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C6orf56

UniProt

O75167

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PHACTR2 Rabbit Polyclonal Antibody (orb589183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001093634.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEMEVHEESRQFTRFHR

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beta-Tubulin Recombinant Antibody [S11B] (OAAV00289)
OAAV00753-200UG 200 µg

Beta-Tubulin Recombinant Antibody [S11B] (OAAV00289)

Sign In for Pricing
View Details
B3GAT1 Antibody Blocking Peptide
orb1511069 500 µg

B3GAT1 Antibody Blocking Peptide

Sign In for Pricing
View Details
BBOX1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV664445 1.0 µg DNA

BBOX1 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Human GSTO1 Knockout A549 cell line
GTR15418897 1 Vial

Human GSTO1 Knockout A549 cell line

Sign In for Pricing
View Details
Anti-ATP5D Antibody
A10129-1 100 µL

Anti-ATP5D Antibody

Sign In for Pricing
View Details
CYB5A Knockout MES-OV Polyclonal Cells
ARG6054 1 Million

CYB5A Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details