PHACTR2 Peptide - C-terminal region
PHACTR2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C6orf56
UniProt
O75167
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PHACTR2 Rabbit Polyclonal Antibody (orb589183) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001093634.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DSPDYDRRADKPWARLTPADKAAIRKELNEFKSTEMEVHEESRQFTRFHR
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6326569-01 0.2 mL
NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (Biotin)
Sign In for Pricing
View Details MBS6326569-02 5x 0.2 mL
NR2E1, ID (NR2E1, TLX, Nuclear receptor subfamily 2 group E member 1, Nuclear receptor TLX, Protein tailless homolog) (Biotin)
Sign In for Pricing
View Details