Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA13 Peptide - middle region

HSPA13 Peptide - middle region

Product Specifications

Product Name Alternative

STCH

UniProt

P48723

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA13 Rabbit Polyclonal Antibody (orb589200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008879.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEMIP Polyclonal Antibody
E-AB-18187-01 20 µL

CEMIP Polyclonal Antibody

Sign In for Pricing
View Details
CEMIP Polyclonal Antibody
E-AB-18187-02 60 µL

CEMIP Polyclonal Antibody

Sign In for Pricing
View Details
CEMIP Polyclonal Antibody
E-AB-18187-03 120 µL

CEMIP Polyclonal Antibody

Sign In for Pricing
View Details
CEMIP Polyclonal Antibody
E-AB-18187-04 200 µL

CEMIP Polyclonal Antibody

Sign In for Pricing
View Details
10-Nonadecanone
TRC-N887463-500MG 500 mg

10-Nonadecanone

Sign In for Pricing
View Details
Recombinant ICAM-2 Monoclonal Antibody
AN301793L-01 50 µL

Recombinant ICAM-2 Monoclonal Antibody

Sign In for Pricing
View Details