Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPA13 Peptide - middle region

HSPA13 Peptide - middle region

Product Specifications

Product Name Alternative

STCH

UniProt

P48723

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HSPA13 Rabbit Polyclonal Antibody (orb589200) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_008879.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MVKLNLTLHQSAQLSVLLTVEEQDRKEPHSSDTELPKDKLSSADDHRVNS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDHR4 Human Gene Knockout Kit (CRISPR)
KN421079 1 Kit

CDHR4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706849 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
SEMA5A (C-term) Rabbit Polyclonal Antibody
AP12325PU-N 400 µL

SEMA5A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAP3K19 (NM_001018046) Human Recombinant Protein
TP319370M 100 µg

MAP3K19 (NM_001018046) Human Recombinant Protein

Sign In for Pricing
View Details
4-(5-oxo-4,5-dihydro-1,2,4-oxadiazol-3-yl)benzoic Acid
TRC-O991843-50MG 50 mg

4-(5-oxo-4,5-dihydro-1,2,4-oxadiazol-3-yl)benzoic Acid

Sign In for Pricing
View Details
PspCI, 500U
RE1314 500 U

PspCI, 500U

Sign In for Pricing
View Details