Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EREG Peptide - middle region

EREG Peptide - middle region

Product Specifications

Product Name Alternative

ER, Ep, EPR

UniProt

O14944

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EREG Rabbit Polyclonal Antibody (orb589204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_001423.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEP

More Discoveries

Explore Other Products

Browse additional items from our catalog

TUFM Rabbit pAb
E2506423 100 µL

TUFM Rabbit pAb

Sign In for Pricing
View Details
Ethambutol dihydrochloride
JH914340 1 Each

Ethambutol dihydrochloride

Sign In for Pricing
View Details
Tgfb3 Mouse shRNA Plasmid (Locus ID 21809)
TL515174 1 Kit

Tgfb3 Mouse shRNA Plasmid (Locus ID 21809)

Sign In for Pricing
View Details
CEP152 Polyclonal Antibody
JOT-AP01693-01 50ul

CEP152 Polyclonal Antibody

Sign In for Pricing
View Details
CEP152 Polyclonal Antibody
JOT-AP01693-02 100ul

CEP152 Polyclonal Antibody

Sign In for Pricing
View Details
Whsc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4948104 1.0 µg DNA

Whsc2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details