EREG Peptide - middle region
EREG Peptide - middle region
Product Specifications
Product Name Alternative
ER, Ep, EPR
UniProt
O14944
Field of Research
Cardiovascular Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EREG Rabbit Polyclonal Antibody (orb589204) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001423.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CEHFFLTVHQPLSKEYVALTVILIILFLITVVGSTYYFCRWYRNRKSKEP
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb930111 100 µL
Phospho-TPH2 (Ser19) Rabbit Polyclonal Antibody (PE-Cy5)
Sign In for Pricing
View Details 
22484111 3x 1.0 µg
GPR110 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
MBS1027174 Inquire
Recombinant Pseudomonas stutzeri ATP synthase subunit b (atpF)
Sign In for Pricing
View Details 
MBS8800513-01 48 Well
Human TACR1 (Tachykinin Receptor 1) ELISA Kit
Sign In for Pricing
View Details