MSANTD3 Peptide - C-terminal region
MSANTD3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
L8, C9orf30
UniProt
Q96H12
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MSANTD3 Rabbit Polyclonal Antibody (orb589223) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_001185734.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1345409-01 0.02 mg (E-Coli)
Recombinant Acinetobacter sp. Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1345409-02 0.1 mg (E-Coli)
Recombinant Acinetobacter sp. Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1345409-03 0.02 mg (Yeast)
Recombinant Acinetobacter sp. Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details MBS1345409-04 0.1 mg (Yeast)
Recombinant Acinetobacter sp. Transcriptional repressor NrdR (nrdR)
Sign In for Pricing
View Details