Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UCP2 Peptide - middle region

UCP2 Peptide - middle region

Product Specifications

Product Name Alternative

UCPH, BMIQ4, SLC25A8

UniProt

P55851

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with UCP2 Rabbit Polyclonal Antibody (orb589241) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003346.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: STTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPN10 Rabbit Polyclonal Antibody (Cy7)
orb1040748 100 µL

CPN10 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
IL20RB Protein Vector (Human) (pPM-C-HA)
PV021327 500 ng

IL20RB Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Human ADAM8
orb1099483-01 50 µg

Recombinant Human ADAM8

Sign In for Pricing
View Details
Recombinant Human ADAM8
orb1099483-02 100 µg

Recombinant Human ADAM8

Sign In for Pricing
View Details
Recombinant Human ADAM8
orb1099483-03 200 µg

Recombinant Human ADAM8

Sign In for Pricing
View Details
Recombinant Human ADAM8
orb1099483-04 1 mg

Recombinant Human ADAM8

Sign In for Pricing
View Details